1. Packages
  2. Packages
  3. Fortimanager Provider
  4. API Docs
  5. WantempSystemSdwanHealthcheck
Viewing docs for fortimanager 1.17.0
published on Monday, May 4, 2026 by fortinetdev
Viewing docs for fortimanager 1.17.0
published on Monday, May 4, 2026 by fortinetdev

    SD-WAN status checking or health checking. Identify a server on the Internet and determine how SD-WAN verifies that the FortiGate can communicate with it.

    This resource is a sub resource for variable health_check of resource fortimanager.WantempSystemSdwan. Conflict and overwrite may occur if use both of them. The following variables have sub resource. Avoid using them together, otherwise conflicts and overwrites may occur.

    • sla: fortimanager.WantempSystemSdwanHealthcheckSla

    Example Usage

    import * as pulumi from "@pulumi/pulumi";
    import * as fortimanager from "@pulumi/fortimanager";
    
    const trnameWanTemplate = new fortimanager.WanTemplate("trname", {
        name: "terr21",
        adom: "root",
        type: "wanprof",
    });
    const trname = new fortimanager.WantempSystemSdwanHealthcheck("trname", {
        addrMode: "ipv4",
        name: "healthcheck",
        wanprof: trnameWanTemplate.name,
    }, {
        dependsOn: [trnameWanTemplate],
    });
    
    import pulumi
    import pulumi_fortimanager as fortimanager
    
    trname_wan_template = fortimanager.WanTemplate("trname",
        name="terr21",
        adom="root",
        type="wanprof")
    trname = fortimanager.WantempSystemSdwanHealthcheck("trname",
        addr_mode="ipv4",
        name="healthcheck",
        wanprof=trname_wan_template.name,
        opts = pulumi.ResourceOptions(depends_on=[trname_wan_template]))
    
    package main
    
    import (
    	"github.com/pulumi/pulumi-terraform-provider/sdks/go/fortimanager/fortimanager"
    	"github.com/pulumi/pulumi/sdk/v3/go/pulumi"
    )
    
    func main() {
    	pulumi.Run(func(ctx *pulumi.Context) error {
    		trnameWanTemplate, err := fortimanager.NewWanTemplate(ctx, "trname", &fortimanager.WanTemplateArgs{
    			Name: pulumi.String("terr21"),
    			Adom: pulumi.String("root"),
    			Type: pulumi.String("wanprof"),
    		})
    		if err != nil {
    			return err
    		}
    		_, err = fortimanager.NewWantempSystemSdwanHealthcheck(ctx, "trname", &fortimanager.WantempSystemSdwanHealthcheckArgs{
    			AddrMode: pulumi.String("ipv4"),
    			Name:     pulumi.String("healthcheck"),
    			Wanprof:  trnameWanTemplate.Name,
    		}, pulumi.DependsOn([]pulumi.Resource{
    			trnameWanTemplate,
    		}))
    		if err != nil {
    			return err
    		}
    		return nil
    	})
    }
    
    using System.Collections.Generic;
    using System.Linq;
    using Pulumi;
    using Fortimanager = Pulumi.Fortimanager;
    
    return await Deployment.RunAsync(() => 
    {
        var trnameWanTemplate = new Fortimanager.WanTemplate("trname", new()
        {
            Name = "terr21",
            Adom = "root",
            Type = "wanprof",
        });
    
        var trname = new Fortimanager.WantempSystemSdwanHealthcheck("trname", new()
        {
            AddrMode = "ipv4",
            Name = "healthcheck",
            Wanprof = trnameWanTemplate.Name,
        }, new CustomResourceOptions
        {
            DependsOn =
            {
                trnameWanTemplate,
            },
        });
    
    });
    
    package generated_program;
    
    import com.pulumi.Context;
    import com.pulumi.Pulumi;
    import com.pulumi.core.Output;
    import com.pulumi.fortimanager.WanTemplate;
    import com.pulumi.fortimanager.WanTemplateArgs;
    import com.pulumi.fortimanager.WantempSystemSdwanHealthcheck;
    import com.pulumi.fortimanager.WantempSystemSdwanHealthcheckArgs;
    import com.pulumi.resources.CustomResourceOptions;
    import java.util.List;
    import java.util.ArrayList;
    import java.util.Map;
    import java.io.File;
    import java.nio.file.Files;
    import java.nio.file.Paths;
    
    public class App {
        public static void main(String[] args) {
            Pulumi.run(App::stack);
        }
    
        public static void stack(Context ctx) {
            var trnameWanTemplate = new WanTemplate("trnameWanTemplate", WanTemplateArgs.builder()
                .name("terr21")
                .adom("root")
                .type("wanprof")
                .build());
    
            var trname = new WantempSystemSdwanHealthcheck("trname", WantempSystemSdwanHealthcheckArgs.builder()
                .addrMode("ipv4")
                .name("healthcheck")
                .wanprof(trnameWanTemplate.name())
                .build(), CustomResourceOptions.builder()
                    .dependsOn(trnameWanTemplate)
                    .build());
    
        }
    }
    
    resources:
      trname:
        type: fortimanager:WantempSystemSdwanHealthcheck
        properties:
          addrMode: ipv4
          name: healthcheck
          wanprof: ${trnameWanTemplate.name}
        options:
          dependsOn:
            - ${trnameWanTemplate}
      trnameWanTemplate:
        type: fortimanager:WanTemplate
        name: trname
        properties:
          name: terr21
          adom: root
          type: wanprof
    
    Example coming soon!
    

    Create WantempSystemSdwanHealthcheck Resource

    Resources are created with functions called constructors. To learn more about declaring and configuring resources, see Resources.

    Constructor syntax

    new WantempSystemSdwanHealthcheck(name: string, args: WantempSystemSdwanHealthcheckArgs, opts?: CustomResourceOptions);
    @overload
    def WantempSystemSdwanHealthcheck(resource_name: str,
                                      args: WantempSystemSdwanHealthcheckArgs,
                                      opts: Optional[ResourceOptions] = None)
    
    @overload
    def WantempSystemSdwanHealthcheck(resource_name: str,
                                      opts: Optional[ResourceOptions] = None,
                                      wanprof: Optional[str] = None,
                                      _dynamic_server: Optional[str] = None,
                                      addr_mode: Optional[str] = None,
                                      adom: Optional[str] = None,
                                      agent_probe_timeout: Optional[float] = None,
                                      bandwidth_weight: Optional[float] = None,
                                      class_id: Optional[str] = None,
                                      detect_mode: Optional[str] = None,
                                      diffservcode: Optional[str] = None,
                                      dns_match_ip: Optional[str] = None,
                                      dns_request_domain: Optional[str] = None,
                                      dynamic_sort_subtable: Optional[str] = None,
                                      embed_measured_health: Optional[str] = None,
                                      failtime: Optional[float] = None,
                                      fortiguard: Optional[str] = None,
                                      fortiguard_names: Optional[Sequence[str]] = None,
                                      ftp_file: Optional[str] = None,
                                      ftp_mode: Optional[str] = None,
                                      ha_priority: Optional[float] = None,
                                      http_agent: Optional[str] = None,
                                      http_get: Optional[str] = None,
                                      http_match: Optional[str] = None,
                                      interval: Optional[float] = None,
                                      jitter_weight: Optional[float] = None,
                                      latency_weight: Optional[float] = None,
                                      members: Optional[Sequence[str]] = None,
                                      mos_codec: Optional[str] = None,
                                      name: Optional[str] = None,
                                      packet_loss_weight: Optional[float] = None,
                                      packet_size: Optional[float] = None,
                                      passwords: Optional[Sequence[str]] = None,
                                      port: Optional[float] = None,
                                      probe_count: Optional[float] = None,
                                      probe_packets: Optional[str] = None,
                                      probe_timeout: Optional[float] = None,
                                      protocol: Optional[str] = None,
                                      quality_measured_method: Optional[str] = None,
                                      recoverytime: Optional[float] = None,
                                      remote_probe_timeout: Optional[float] = None,
                                      scopetype: Optional[str] = None,
                                      security_mode: Optional[str] = None,
                                      servers: Optional[Sequence[str]] = None,
                                      sla_fail_log_period: Optional[float] = None,
                                      sla_id_redistribute: Optional[float] = None,
                                      sla_pass_log_period: Optional[float] = None,
                                      slas: Optional[Sequence[WantempSystemSdwanHealthcheckSlaArgs]] = None,
                                      source: Optional[str] = None,
                                      source6: Optional[str] = None,
                                      system_dns: Optional[str] = None,
                                      threshold_alert_jitter: Optional[float] = None,
                                      threshold_alert_latency: Optional[float] = None,
                                      threshold_alert_packetloss: Optional[float] = None,
                                      threshold_warning_jitter: Optional[float] = None,
                                      threshold_warning_latency: Optional[float] = None,
                                      threshold_warning_packetloss: Optional[float] = None,
                                      update_bgp_route: Optional[str] = None,
                                      update_cascade_interface: Optional[str] = None,
                                      update_if_exist: Optional[bool] = None,
                                      update_static_route: Optional[str] = None,
                                      user: Optional[str] = None,
                                      vrf: Optional[float] = None,
                                      wantemp_system_sdwan_healthcheck_id: Optional[str] = None)
    func NewWantempSystemSdwanHealthcheck(ctx *Context, name string, args WantempSystemSdwanHealthcheckArgs, opts ...ResourceOption) (*WantempSystemSdwanHealthcheck, error)
    public WantempSystemSdwanHealthcheck(string name, WantempSystemSdwanHealthcheckArgs args, CustomResourceOptions? opts = null)
    public WantempSystemSdwanHealthcheck(String name, WantempSystemSdwanHealthcheckArgs args)
    public WantempSystemSdwanHealthcheck(String name, WantempSystemSdwanHealthcheckArgs args, CustomResourceOptions options)
    
    type: fortimanager:WantempSystemSdwanHealthcheck
    properties: # The arguments to resource properties.
    options: # Bag of options to control resource's behavior.
    
    
    resource "fortimanager_wantempsystemsdwanhealthcheck" "name" {
        # resource properties
    }

    Parameters

    name string
    The unique name of the resource.
    args WantempSystemSdwanHealthcheckArgs
    The arguments to resource properties.
    opts CustomResourceOptions
    Bag of options to control resource's behavior.
    resource_name str
    The unique name of the resource.
    args WantempSystemSdwanHealthcheckArgs
    The arguments to resource properties.
    opts ResourceOptions
    Bag of options to control resource's behavior.
    ctx Context
    Context object for the current deployment.
    name string
    The unique name of the resource.
    args WantempSystemSdwanHealthcheckArgs
    The arguments to resource properties.
    opts ResourceOption
    Bag of options to control resource's behavior.
    name string
    The unique name of the resource.
    args WantempSystemSdwanHealthcheckArgs
    The arguments to resource properties.
    opts CustomResourceOptions
    Bag of options to control resource's behavior.
    name String
    The unique name of the resource.
    args WantempSystemSdwanHealthcheckArgs
    The arguments to resource properties.
    options CustomResourceOptions
    Bag of options to control resource's behavior.

    Constructor example

    The following reference example uses placeholder values for all input properties.

    var wantempSystemSdwanHealthcheckResource = new Fortimanager.WantempSystemSdwanHealthcheck("wantempSystemSdwanHealthcheckResource", new()
    {
        Wanprof = "string",
        _dynamicServer = "string",
        AddrMode = "string",
        Adom = "string",
        AgentProbeTimeout = 0,
        BandwidthWeight = 0,
        ClassId = "string",
        DetectMode = "string",
        Diffservcode = "string",
        DnsMatchIp = "string",
        DnsRequestDomain = "string",
        DynamicSortSubtable = "string",
        EmbedMeasuredHealth = "string",
        Failtime = 0,
        Fortiguard = "string",
        FortiguardNames = new[]
        {
            "string",
        },
        FtpFile = "string",
        FtpMode = "string",
        HaPriority = 0,
        HttpAgent = "string",
        HttpGet = "string",
        HttpMatch = "string",
        Interval = 0,
        JitterWeight = 0,
        LatencyWeight = 0,
        Members = new[]
        {
            "string",
        },
        MosCodec = "string",
        Name = "string",
        PacketLossWeight = 0,
        PacketSize = 0,
        Passwords = new[]
        {
            "string",
        },
        Port = 0,
        ProbeCount = 0,
        ProbePackets = "string",
        ProbeTimeout = 0,
        Protocol = "string",
        QualityMeasuredMethod = "string",
        Recoverytime = 0,
        RemoteProbeTimeout = 0,
        Scopetype = "string",
        SecurityMode = "string",
        Servers = new[]
        {
            "string",
        },
        SlaFailLogPeriod = 0,
        SlaIdRedistribute = 0,
        SlaPassLogPeriod = 0,
        Slas = new[]
        {
            new Fortimanager.Inputs.WantempSystemSdwanHealthcheckSlaArgs
            {
                CustomProfileThreshold = 0,
                Id = 0,
                JitterThreshold = 0,
                LatencyThreshold = 0,
                LinkCostFactors = new[]
                {
                    "string",
                },
                MosThreshold = "string",
                PacketlossThreshold = 0,
                PriorityInSla = 0,
                PriorityOutSla = 0,
            },
        },
        Source = "string",
        Source6 = "string",
        SystemDns = "string",
        ThresholdAlertJitter = 0,
        ThresholdAlertLatency = 0,
        ThresholdAlertPacketloss = 0,
        ThresholdWarningJitter = 0,
        ThresholdWarningLatency = 0,
        ThresholdWarningPacketloss = 0,
        UpdateBgpRoute = "string",
        UpdateCascadeInterface = "string",
        UpdateIfExist = false,
        UpdateStaticRoute = "string",
        User = "string",
        Vrf = 0,
        WantempSystemSdwanHealthcheckId = "string",
    });
    
    example, err := fortimanager.NewWantempSystemSdwanHealthcheck(ctx, "wantempSystemSdwanHealthcheckResource", &fortimanager.WantempSystemSdwanHealthcheckArgs{
    	Wanprof:             pulumi.String("string"),
    	_dynamicServer:      pulumi.String("string"),
    	AddrMode:            pulumi.String("string"),
    	Adom:                pulumi.String("string"),
    	AgentProbeTimeout:   pulumi.Float64(0),
    	BandwidthWeight:     pulumi.Float64(0),
    	ClassId:             pulumi.String("string"),
    	DetectMode:          pulumi.String("string"),
    	Diffservcode:        pulumi.String("string"),
    	DnsMatchIp:          pulumi.String("string"),
    	DnsRequestDomain:    pulumi.String("string"),
    	DynamicSortSubtable: pulumi.String("string"),
    	EmbedMeasuredHealth: pulumi.String("string"),
    	Failtime:            pulumi.Float64(0),
    	Fortiguard:          pulumi.String("string"),
    	FortiguardNames: pulumi.StringArray{
    		pulumi.String("string"),
    	},
    	FtpFile:       pulumi.String("string"),
    	FtpMode:       pulumi.String("string"),
    	HaPriority:    pulumi.Float64(0),
    	HttpAgent:     pulumi.String("string"),
    	HttpGet:       pulumi.String("string"),
    	HttpMatch:     pulumi.String("string"),
    	Interval:      pulumi.Float64(0),
    	JitterWeight:  pulumi.Float64(0),
    	LatencyWeight: pulumi.Float64(0),
    	Members: pulumi.StringArray{
    		pulumi.String("string"),
    	},
    	MosCodec:         pulumi.String("string"),
    	Name:             pulumi.String("string"),
    	PacketLossWeight: pulumi.Float64(0),
    	PacketSize:       pulumi.Float64(0),
    	Passwords: pulumi.StringArray{
    		pulumi.String("string"),
    	},
    	Port:                  pulumi.Float64(0),
    	ProbeCount:            pulumi.Float64(0),
    	ProbePackets:          pulumi.String("string"),
    	ProbeTimeout:          pulumi.Float64(0),
    	Protocol:              pulumi.String("string"),
    	QualityMeasuredMethod: pulumi.String("string"),
    	Recoverytime:          pulumi.Float64(0),
    	RemoteProbeTimeout:    pulumi.Float64(0),
    	Scopetype:             pulumi.String("string"),
    	SecurityMode:          pulumi.String("string"),
    	Servers: pulumi.StringArray{
    		pulumi.String("string"),
    	},
    	SlaFailLogPeriod:  pulumi.Float64(0),
    	SlaIdRedistribute: pulumi.Float64(0),
    	SlaPassLogPeriod:  pulumi.Float64(0),
    	Slas: fortimanager.WantempSystemSdwanHealthcheckSlaTypeArray{
    		&fortimanager.WantempSystemSdwanHealthcheckSlaTypeArgs{
    			CustomProfileThreshold: pulumi.Float64(0),
    			Id:                     pulumi.Float64(0),
    			JitterThreshold:        pulumi.Float64(0),
    			LatencyThreshold:       pulumi.Float64(0),
    			LinkCostFactors: pulumi.StringArray{
    				pulumi.String("string"),
    			},
    			MosThreshold:        pulumi.String("string"),
    			PacketlossThreshold: pulumi.Float64(0),
    			PriorityInSla:       pulumi.Float64(0),
    			PriorityOutSla:      pulumi.Float64(0),
    		},
    	},
    	Source:                          pulumi.String("string"),
    	Source6:                         pulumi.String("string"),
    	SystemDns:                       pulumi.String("string"),
    	ThresholdAlertJitter:            pulumi.Float64(0),
    	ThresholdAlertLatency:           pulumi.Float64(0),
    	ThresholdAlertPacketloss:        pulumi.Float64(0),
    	ThresholdWarningJitter:          pulumi.Float64(0),
    	ThresholdWarningLatency:         pulumi.Float64(0),
    	ThresholdWarningPacketloss:      pulumi.Float64(0),
    	UpdateBgpRoute:                  pulumi.String("string"),
    	UpdateCascadeInterface:          pulumi.String("string"),
    	UpdateIfExist:                   pulumi.Bool(false),
    	UpdateStaticRoute:               pulumi.String("string"),
    	User:                            pulumi.String("string"),
    	Vrf:                             pulumi.Float64(0),
    	WantempSystemSdwanHealthcheckId: pulumi.String("string"),
    })
    
    resource "fortimanager_wantempsystemsdwanhealthcheck" "wantempSystemSdwanHealthcheckResource" {
      wanprof                 = "string"
      _dynamic_server         = "string"
      addr_mode               = "string"
      adom                    = "string"
      agent_probe_timeout     = 0
      bandwidth_weight        = 0
      class_id                = "string"
      detect_mode             = "string"
      diffservcode            = "string"
      dns_match_ip            = "string"
      dns_request_domain      = "string"
      dynamic_sort_subtable   = "string"
      embed_measured_health   = "string"
      failtime                = 0
      fortiguard              = "string"
      fortiguard_names        = ["string"]
      ftp_file                = "string"
      ftp_mode                = "string"
      ha_priority             = 0
      http_agent              = "string"
      http_get                = "string"
      http_match              = "string"
      interval                = 0
      jitter_weight           = 0
      latency_weight          = 0
      members                 = ["string"]
      mos_codec               = "string"
      name                    = "string"
      packet_loss_weight      = 0
      packet_size             = 0
      passwords               = ["string"]
      port                    = 0
      probe_count             = 0
      probe_packets           = "string"
      probe_timeout           = 0
      protocol                = "string"
      quality_measured_method = "string"
      recoverytime            = 0
      remote_probe_timeout    = 0
      scopetype               = "string"
      security_mode           = "string"
      servers                 = ["string"]
      sla_fail_log_period     = 0
      sla_id_redistribute     = 0
      sla_pass_log_period     = 0
      slas {
        custom_profile_threshold = 0
        id                       = 0
        jitter_threshold         = 0
        latency_threshold        = 0
        link_cost_factors        = ["string"]
        mos_threshold            = "string"
        packetloss_threshold     = 0
        priority_in_sla          = 0
        priority_out_sla         = 0
      }
      source                              = "string"
      source6                             = "string"
      system_dns                          = "string"
      threshold_alert_jitter              = 0
      threshold_alert_latency             = 0
      threshold_alert_packetloss          = 0
      threshold_warning_jitter            = 0
      threshold_warning_latency           = 0
      threshold_warning_packetloss        = 0
      update_bgp_route                    = "string"
      update_cascade_interface            = "string"
      update_if_exist                     = false
      update_static_route                 = "string"
      user                                = "string"
      vrf                                 = 0
      wantemp_system_sdwan_healthcheck_id = "string"
    }
    
    var wantempSystemSdwanHealthcheckResource = new WantempSystemSdwanHealthcheck("wantempSystemSdwanHealthcheckResource", WantempSystemSdwanHealthcheckArgs.builder()
        .wanprof("string")
        ._dynamicServer("string")
        .addrMode("string")
        .adom("string")
        .agentProbeTimeout(0.0)
        .bandwidthWeight(0.0)
        .classId("string")
        .detectMode("string")
        .diffservcode("string")
        .dnsMatchIp("string")
        .dnsRequestDomain("string")
        .dynamicSortSubtable("string")
        .embedMeasuredHealth("string")
        .failtime(0.0)
        .fortiguard("string")
        .fortiguardNames("string")
        .ftpFile("string")
        .ftpMode("string")
        .haPriority(0.0)
        .httpAgent("string")
        .httpGet("string")
        .httpMatch("string")
        .interval(0.0)
        .jitterWeight(0.0)
        .latencyWeight(0.0)
        .members("string")
        .mosCodec("string")
        .name("string")
        .packetLossWeight(0.0)
        .packetSize(0.0)
        .passwords("string")
        .port(0.0)
        .probeCount(0.0)
        .probePackets("string")
        .probeTimeout(0.0)
        .protocol("string")
        .qualityMeasuredMethod("string")
        .recoverytime(0.0)
        .remoteProbeTimeout(0.0)
        .scopetype("string")
        .securityMode("string")
        .servers("string")
        .slaFailLogPeriod(0.0)
        .slaIdRedistribute(0.0)
        .slaPassLogPeriod(0.0)
        .slas(com.pulumi.fortimanager.inputs.WantempSystemSdwanHealthcheckSlaArgs.builder()
            .customProfileThreshold(0.0)
            .id(0.0)
            .jitterThreshold(0.0)
            .latencyThreshold(0.0)
            .linkCostFactors("string")
            .mosThreshold("string")
            .packetlossThreshold(0.0)
            .priorityInSla(0.0)
            .priorityOutSla(0.0)
            .build())
        .source("string")
        .source6("string")
        .systemDns("string")
        .thresholdAlertJitter(0.0)
        .thresholdAlertLatency(0.0)
        .thresholdAlertPacketloss(0.0)
        .thresholdWarningJitter(0.0)
        .thresholdWarningLatency(0.0)
        .thresholdWarningPacketloss(0.0)
        .updateBgpRoute("string")
        .updateCascadeInterface("string")
        .updateIfExist(false)
        .updateStaticRoute("string")
        .user("string")
        .vrf(0.0)
        .wantempSystemSdwanHealthcheckId("string")
        .build());
    
    wantemp_system_sdwan_healthcheck_resource = fortimanager.WantempSystemSdwanHealthcheck("wantempSystemSdwanHealthcheckResource",
        wanprof="string",
        _dynamic_server="string",
        addr_mode="string",
        adom="string",
        agent_probe_timeout=float(0),
        bandwidth_weight=float(0),
        class_id="string",
        detect_mode="string",
        diffservcode="string",
        dns_match_ip="string",
        dns_request_domain="string",
        dynamic_sort_subtable="string",
        embed_measured_health="string",
        failtime=float(0),
        fortiguard="string",
        fortiguard_names=["string"],
        ftp_file="string",
        ftp_mode="string",
        ha_priority=float(0),
        http_agent="string",
        http_get="string",
        http_match="string",
        interval=float(0),
        jitter_weight=float(0),
        latency_weight=float(0),
        members=["string"],
        mos_codec="string",
        name="string",
        packet_loss_weight=float(0),
        packet_size=float(0),
        passwords=["string"],
        port=float(0),
        probe_count=float(0),
        probe_packets="string",
        probe_timeout=float(0),
        protocol="string",
        quality_measured_method="string",
        recoverytime=float(0),
        remote_probe_timeout=float(0),
        scopetype="string",
        security_mode="string",
        servers=["string"],
        sla_fail_log_period=float(0),
        sla_id_redistribute=float(0),
        sla_pass_log_period=float(0),
        slas=[{
            "custom_profile_threshold": float(0),
            "id": float(0),
            "jitter_threshold": float(0),
            "latency_threshold": float(0),
            "link_cost_factors": ["string"],
            "mos_threshold": "string",
            "packetloss_threshold": float(0),
            "priority_in_sla": float(0),
            "priority_out_sla": float(0),
        }],
        source="string",
        source6="string",
        system_dns="string",
        threshold_alert_jitter=float(0),
        threshold_alert_latency=float(0),
        threshold_alert_packetloss=float(0),
        threshold_warning_jitter=float(0),
        threshold_warning_latency=float(0),
        threshold_warning_packetloss=float(0),
        update_bgp_route="string",
        update_cascade_interface="string",
        update_if_exist=False,
        update_static_route="string",
        user="string",
        vrf=float(0),
        wantemp_system_sdwan_healthcheck_id="string")
    
    const wantempSystemSdwanHealthcheckResource = new fortimanager.WantempSystemSdwanHealthcheck("wantempSystemSdwanHealthcheckResource", {
        wanprof: "string",
        _dynamicServer: "string",
        addrMode: "string",
        adom: "string",
        agentProbeTimeout: 0,
        bandwidthWeight: 0,
        classId: "string",
        detectMode: "string",
        diffservcode: "string",
        dnsMatchIp: "string",
        dnsRequestDomain: "string",
        dynamicSortSubtable: "string",
        embedMeasuredHealth: "string",
        failtime: 0,
        fortiguard: "string",
        fortiguardNames: ["string"],
        ftpFile: "string",
        ftpMode: "string",
        haPriority: 0,
        httpAgent: "string",
        httpGet: "string",
        httpMatch: "string",
        interval: 0,
        jitterWeight: 0,
        latencyWeight: 0,
        members: ["string"],
        mosCodec: "string",
        name: "string",
        packetLossWeight: 0,
        packetSize: 0,
        passwords: ["string"],
        port: 0,
        probeCount: 0,
        probePackets: "string",
        probeTimeout: 0,
        protocol: "string",
        qualityMeasuredMethod: "string",
        recoverytime: 0,
        remoteProbeTimeout: 0,
        scopetype: "string",
        securityMode: "string",
        servers: ["string"],
        slaFailLogPeriod: 0,
        slaIdRedistribute: 0,
        slaPassLogPeriod: 0,
        slas: [{
            customProfileThreshold: 0,
            id: 0,
            jitterThreshold: 0,
            latencyThreshold: 0,
            linkCostFactors: ["string"],
            mosThreshold: "string",
            packetlossThreshold: 0,
            priorityInSla: 0,
            priorityOutSla: 0,
        }],
        source: "string",
        source6: "string",
        systemDns: "string",
        thresholdAlertJitter: 0,
        thresholdAlertLatency: 0,
        thresholdAlertPacketloss: 0,
        thresholdWarningJitter: 0,
        thresholdWarningLatency: 0,
        thresholdWarningPacketloss: 0,
        updateBgpRoute: "string",
        updateCascadeInterface: "string",
        updateIfExist: false,
        updateStaticRoute: "string",
        user: "string",
        vrf: 0,
        wantempSystemSdwanHealthcheckId: "string",
    });
    
    type: fortimanager:WantempSystemSdwanHealthcheck
    properties:
        _dynamicServer: string
        addrMode: string
        adom: string
        agentProbeTimeout: 0
        bandwidthWeight: 0
        classId: string
        detectMode: string
        diffservcode: string
        dnsMatchIp: string
        dnsRequestDomain: string
        dynamicSortSubtable: string
        embedMeasuredHealth: string
        failtime: 0
        fortiguard: string
        fortiguardNames:
            - string
        ftpFile: string
        ftpMode: string
        haPriority: 0
        httpAgent: string
        httpGet: string
        httpMatch: string
        interval: 0
        jitterWeight: 0
        latencyWeight: 0
        members:
            - string
        mosCodec: string
        name: string
        packetLossWeight: 0
        packetSize: 0
        passwords:
            - string
        port: 0
        probeCount: 0
        probePackets: string
        probeTimeout: 0
        protocol: string
        qualityMeasuredMethod: string
        recoverytime: 0
        remoteProbeTimeout: 0
        scopetype: string
        securityMode: string
        servers:
            - string
        slaFailLogPeriod: 0
        slaIdRedistribute: 0
        slaPassLogPeriod: 0
        slas:
            - customProfileThreshold: 0
              id: 0
              jitterThreshold: 0
              latencyThreshold: 0
              linkCostFactors:
                - string
              mosThreshold: string
              packetlossThreshold: 0
              priorityInSla: 0
              priorityOutSla: 0
        source: string
        source6: string
        systemDns: string
        thresholdAlertJitter: 0
        thresholdAlertLatency: 0
        thresholdAlertPacketloss: 0
        thresholdWarningJitter: 0
        thresholdWarningLatency: 0
        thresholdWarningPacketloss: 0
        updateBgpRoute: string
        updateCascadeInterface: string
        updateIfExist: false
        updateStaticRoute: string
        user: string
        vrf: 0
        wanprof: string
        wantempSystemSdwanHealthcheckId: string
    

    WantempSystemSdwanHealthcheck Resource Properties

    To learn more about resource properties and how to use them, see Inputs and Outputs in the Architecture and Concepts docs.

    Inputs

    In Python, inputs that are objects can be passed either as argument classes or as dictionary literals.

    The WantempSystemSdwanHealthcheck resource accepts the following input properties:

    Wanprof string
    Wanprof.
    AddrMode string
    Address mode (IPv4 or IPv6). Valid values: ipv4, ipv6.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    AgentProbeTimeout double
    Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
    BandwidthWeight double
    Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
    ClassId string
    Traffic class ID.
    DetectMode string
    The mode determining how to detect the server. Valid values: active, passive, prefer-passive.
    Diffservcode string
    Differentiated services code point (DSCP) in the IP header of the probe packet.
    DnsMatchIp string
    Response IP expected from DNS server if the protocol is DNS.
    DnsRequestDomain string
    Fully qualified domain name to resolve for the DNS probe.
    DynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    EmbedMeasuredHealth string
    Enable/disable embedding measured health information. Valid values: disable, enable.
    Failtime double
    Number of failures before server is considered lost (1 - 3600, default = 5).
    Fortiguard string
    Enable/disable use of FortiGuard predefined server. Valid values: disable, enable.
    FortiguardNames List<string>
    Predefined health-check target name.
    FtpFile string
    Full path and file name on the FTP server to download for FTP health-check to probe.
    FtpMode string
    FTP mode. Valid values: passive, port.
    HaPriority double
    HA election priority (1 - 50).
    HttpAgent string
    String in the http-agent field in the HTTP header.
    HttpGet string
    URL used to communicate with the server if the protocol if the protocol is HTTP.
    HttpMatch string
    Response string expected from the server if the protocol is HTTP.
    Interval double
    Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
    JitterWeight double
    Coefficient of jitter in the formula of custom-profile-1.
    LatencyWeight double
    Coefficient of latency in the formula of custom-profile-1.
    Members List<string>
    Member sequence number list.
    MosCodec string
    Codec to use for MOS calculation (default = g711). Valid values: g711, g722, g729.
    Name string
    Status check or health check name.
    PacketLossWeight double
    Coefficient of packet-loss in the formula of custom-profile-1.
    PacketSize double
    Packet size of a twamp test session,
    Passwords List<string>
    Twamp controller password in authentication mode
    Port double
    Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
    ProbeCount double
    Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
    ProbePackets string
    Enable/disable transmission of probe packets. Valid values: disable, enable.
    ProbeTimeout double
    Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
    Protocol string
    Protocol used to determine if the FortiGate can communicate with the server. Valid values: ping, tcp-echo, udp-echo, http, twamp, ping6, dns, tcp-connect, ftp.
    QualityMeasuredMethod string
    Method to measure the quality of tcp-connect. Valid values: half-close, half-open.
    Recoverytime double
    Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
    RemoteProbeTimeout double
    Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    SecurityMode string
    Twamp controller security mode. Valid values: none, authentication.
    Servers List<string>
    IP address or FQDN name of the server.
    SlaFailLogPeriod double
    Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
    SlaIdRedistribute double
    Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
    SlaPassLogPeriod double
    Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
    Slas List<WantempSystemSdwanHealthcheckSla>
    Sla. The structure of sla block is documented below.
    Source string
    Source IP address used in the health-check packet to the server.
    Source6 string
    Source IPv6 addressused in the health-check packet to server.
    SystemDns string
    Enable/disable system DNS as the probe server. Valid values: disable, enable.
    ThresholdAlertJitter double
    Alert threshold for jitter (ms, default = 0).
    ThresholdAlertLatency double
    Alert threshold for latency (ms, default = 0).
    ThresholdAlertPacketloss double
    Alert threshold for packet loss (percentage, default = 0).
    ThresholdWarningJitter double
    Warning threshold for jitter (ms, default = 0).
    ThresholdWarningLatency double
    Warning threshold for latency (ms, default = 0).
    ThresholdWarningPacketloss double
    Warning threshold for packet loss (percentage, default = 0).
    UpdateBgpRoute string
    Enable/disable updating the BGP route. Valid values: disable, enable.
    UpdateCascadeInterface string
    Enable/disable update cascade interface. Valid values: disable, enable.
    UpdateIfExist bool
    UpdateStaticRoute string
    Enable/disable updating the static route. Valid values: disable, enable.
    User string
    The user name to access probe server.
    Vrf double
    Virtual Routing Forwarding ID.
    WantempSystemSdwanHealthcheckId string
    an identifier for the resource with format {{name}}.
    _dynamicServer string
    _Dynamic-Server.
    Wanprof string
    Wanprof.
    AddrMode string
    Address mode (IPv4 or IPv6). Valid values: ipv4, ipv6.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    AgentProbeTimeout float64
    Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
    BandwidthWeight float64
    Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
    ClassId string
    Traffic class ID.
    DetectMode string
    The mode determining how to detect the server. Valid values: active, passive, prefer-passive.
    Diffservcode string
    Differentiated services code point (DSCP) in the IP header of the probe packet.
    DnsMatchIp string
    Response IP expected from DNS server if the protocol is DNS.
    DnsRequestDomain string
    Fully qualified domain name to resolve for the DNS probe.
    DynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    EmbedMeasuredHealth string
    Enable/disable embedding measured health information. Valid values: disable, enable.
    Failtime float64
    Number of failures before server is considered lost (1 - 3600, default = 5).
    Fortiguard string
    Enable/disable use of FortiGuard predefined server. Valid values: disable, enable.
    FortiguardNames []string
    Predefined health-check target name.
    FtpFile string
    Full path and file name on the FTP server to download for FTP health-check to probe.
    FtpMode string
    FTP mode. Valid values: passive, port.
    HaPriority float64
    HA election priority (1 - 50).
    HttpAgent string
    String in the http-agent field in the HTTP header.
    HttpGet string
    URL used to communicate with the server if the protocol if the protocol is HTTP.
    HttpMatch string
    Response string expected from the server if the protocol is HTTP.
    Interval float64
    Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
    JitterWeight float64
    Coefficient of jitter in the formula of custom-profile-1.
    LatencyWeight float64
    Coefficient of latency in the formula of custom-profile-1.
    Members []string
    Member sequence number list.
    MosCodec string
    Codec to use for MOS calculation (default = g711). Valid values: g711, g722, g729.
    Name string
    Status check or health check name.
    PacketLossWeight float64
    Coefficient of packet-loss in the formula of custom-profile-1.
    PacketSize float64
    Packet size of a twamp test session,
    Passwords []string
    Twamp controller password in authentication mode
    Port float64
    Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
    ProbeCount float64
    Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
    ProbePackets string
    Enable/disable transmission of probe packets. Valid values: disable, enable.
    ProbeTimeout float64
    Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
    Protocol string
    Protocol used to determine if the FortiGate can communicate with the server. Valid values: ping, tcp-echo, udp-echo, http, twamp, ping6, dns, tcp-connect, ftp.
    QualityMeasuredMethod string
    Method to measure the quality of tcp-connect. Valid values: half-close, half-open.
    Recoverytime float64
    Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
    RemoteProbeTimeout float64
    Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    SecurityMode string
    Twamp controller security mode. Valid values: none, authentication.
    Servers []string
    IP address or FQDN name of the server.
    SlaFailLogPeriod float64
    Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
    SlaIdRedistribute float64
    Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
    SlaPassLogPeriod float64
    Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
    Slas []WantempSystemSdwanHealthcheckSlaTypeArgs
    Sla. The structure of sla block is documented below.
    Source string
    Source IP address used in the health-check packet to the server.
    Source6 string
    Source IPv6 addressused in the health-check packet to server.
    SystemDns string
    Enable/disable system DNS as the probe server. Valid values: disable, enable.
    ThresholdAlertJitter float64
    Alert threshold for jitter (ms, default = 0).
    ThresholdAlertLatency float64
    Alert threshold for latency (ms, default = 0).
    ThresholdAlertPacketloss float64
    Alert threshold for packet loss (percentage, default = 0).
    ThresholdWarningJitter float64
    Warning threshold for jitter (ms, default = 0).
    ThresholdWarningLatency float64
    Warning threshold for latency (ms, default = 0).
    ThresholdWarningPacketloss float64
    Warning threshold for packet loss (percentage, default = 0).
    UpdateBgpRoute string
    Enable/disable updating the BGP route. Valid values: disable, enable.
    UpdateCascadeInterface string
    Enable/disable update cascade interface. Valid values: disable, enable.
    UpdateIfExist bool
    UpdateStaticRoute string
    Enable/disable updating the static route. Valid values: disable, enable.
    User string
    The user name to access probe server.
    Vrf float64
    Virtual Routing Forwarding ID.
    WantempSystemSdwanHealthcheckId string
    an identifier for the resource with format {{name}}.
    _dynamicServer string
    _Dynamic-Server.
    wanprof string
    Wanprof.
    _dynamic_server string
    _Dynamic-Server.
    addr_mode string
    Address mode (IPv4 or IPv6). Valid values: ipv4, ipv6.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    agent_probe_timeout number
    Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
    bandwidth_weight number
    Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
    class_id string
    Traffic class ID.
    detect_mode string
    The mode determining how to detect the server. Valid values: active, passive, prefer-passive.
    diffservcode string
    Differentiated services code point (DSCP) in the IP header of the probe packet.
    dns_match_ip string
    Response IP expected from DNS server if the protocol is DNS.
    dns_request_domain string
    Fully qualified domain name to resolve for the DNS probe.
    dynamic_sort_subtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    embed_measured_health string
    Enable/disable embedding measured health information. Valid values: disable, enable.
    failtime number
    Number of failures before server is considered lost (1 - 3600, default = 5).
    fortiguard string
    Enable/disable use of FortiGuard predefined server. Valid values: disable, enable.
    fortiguard_names list(string)
    Predefined health-check target name.
    ftp_file string
    Full path and file name on the FTP server to download for FTP health-check to probe.
    ftp_mode string
    FTP mode. Valid values: passive, port.
    ha_priority number
    HA election priority (1 - 50).
    http_agent string
    String in the http-agent field in the HTTP header.
    http_get string
    URL used to communicate with the server if the protocol if the protocol is HTTP.
    http_match string
    Response string expected from the server if the protocol is HTTP.
    interval number
    Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
    jitter_weight number
    Coefficient of jitter in the formula of custom-profile-1.
    latency_weight number
    Coefficient of latency in the formula of custom-profile-1.
    members list(string)
    Member sequence number list.
    mos_codec string
    Codec to use for MOS calculation (default = g711). Valid values: g711, g722, g729.
    name string
    Status check or health check name.
    packet_loss_weight number
    Coefficient of packet-loss in the formula of custom-profile-1.
    packet_size number
    Packet size of a twamp test session,
    passwords list(string)
    Twamp controller password in authentication mode
    port number
    Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
    probe_count number
    Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
    probe_packets string
    Enable/disable transmission of probe packets. Valid values: disable, enable.
    probe_timeout number
    Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
    protocol string
    Protocol used to determine if the FortiGate can communicate with the server. Valid values: ping, tcp-echo, udp-echo, http, twamp, ping6, dns, tcp-connect, ftp.
    quality_measured_method string
    Method to measure the quality of tcp-connect. Valid values: half-close, half-open.
    recoverytime number
    Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
    remote_probe_timeout number
    Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    security_mode string
    Twamp controller security mode. Valid values: none, authentication.
    servers list(string)
    IP address or FQDN name of the server.
    sla_fail_log_period number
    Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
    sla_id_redistribute number
    Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
    sla_pass_log_period number
    Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
    slas list(object)
    Sla. The structure of sla block is documented below.
    source string
    Source IP address used in the health-check packet to the server.
    source6 string
    Source IPv6 addressused in the health-check packet to server.
    system_dns string
    Enable/disable system DNS as the probe server. Valid values: disable, enable.
    threshold_alert_jitter number
    Alert threshold for jitter (ms, default = 0).
    threshold_alert_latency number
    Alert threshold for latency (ms, default = 0).
    threshold_alert_packetloss number
    Alert threshold for packet loss (percentage, default = 0).
    threshold_warning_jitter number
    Warning threshold for jitter (ms, default = 0).
    threshold_warning_latency number
    Warning threshold for latency (ms, default = 0).
    threshold_warning_packetloss number
    Warning threshold for packet loss (percentage, default = 0).
    update_bgp_route string
    Enable/disable updating the BGP route. Valid values: disable, enable.
    update_cascade_interface string
    Enable/disable update cascade interface. Valid values: disable, enable.
    update_if_exist bool
    update_static_route string
    Enable/disable updating the static route. Valid values: disable, enable.
    user string
    The user name to access probe server.
    vrf number
    Virtual Routing Forwarding ID.
    wantemp_system_sdwan_healthcheck_id string
    an identifier for the resource with format {{name}}.
    wanprof String
    Wanprof.
    _dynamicServer String
    _Dynamic-Server.
    addrMode String
    Address mode (IPv4 or IPv6). Valid values: ipv4, ipv6.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    agentProbeTimeout Double
    Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
    bandwidthWeight Double
    Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
    classId String
    Traffic class ID.
    detectMode String
    The mode determining how to detect the server. Valid values: active, passive, prefer-passive.
    diffservcode String
    Differentiated services code point (DSCP) in the IP header of the probe packet.
    dnsMatchIp String
    Response IP expected from DNS server if the protocol is DNS.
    dnsRequestDomain String
    Fully qualified domain name to resolve for the DNS probe.
    dynamicSortSubtable String
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    embedMeasuredHealth String
    Enable/disable embedding measured health information. Valid values: disable, enable.
    failtime Double
    Number of failures before server is considered lost (1 - 3600, default = 5).
    fortiguard String
    Enable/disable use of FortiGuard predefined server. Valid values: disable, enable.
    fortiguardNames List<String>
    Predefined health-check target name.
    ftpFile String
    Full path and file name on the FTP server to download for FTP health-check to probe.
    ftpMode String
    FTP mode. Valid values: passive, port.
    haPriority Double
    HA election priority (1 - 50).
    httpAgent String
    String in the http-agent field in the HTTP header.
    httpGet String
    URL used to communicate with the server if the protocol if the protocol is HTTP.
    httpMatch String
    Response string expected from the server if the protocol is HTTP.
    interval Double
    Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
    jitterWeight Double
    Coefficient of jitter in the formula of custom-profile-1.
    latencyWeight Double
    Coefficient of latency in the formula of custom-profile-1.
    members List<String>
    Member sequence number list.
    mosCodec String
    Codec to use for MOS calculation (default = g711). Valid values: g711, g722, g729.
    name String
    Status check or health check name.
    packetLossWeight Double
    Coefficient of packet-loss in the formula of custom-profile-1.
    packetSize Double
    Packet size of a twamp test session,
    passwords List<String>
    Twamp controller password in authentication mode
    port Double
    Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
    probeCount Double
    Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
    probePackets String
    Enable/disable transmission of probe packets. Valid values: disable, enable.
    probeTimeout Double
    Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
    protocol String
    Protocol used to determine if the FortiGate can communicate with the server. Valid values: ping, tcp-echo, udp-echo, http, twamp, ping6, dns, tcp-connect, ftp.
    qualityMeasuredMethod String
    Method to measure the quality of tcp-connect. Valid values: half-close, half-open.
    recoverytime Double
    Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
    remoteProbeTimeout Double
    Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    securityMode String
    Twamp controller security mode. Valid values: none, authentication.
    servers List<String>
    IP address or FQDN name of the server.
    slaFailLogPeriod Double
    Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
    slaIdRedistribute Double
    Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
    slaPassLogPeriod Double
    Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
    slas List<WantempSystemSdwanHealthcheckSla>
    Sla. The structure of sla block is documented below.
    source String
    Source IP address used in the health-check packet to the server.
    source6 String
    Source IPv6 addressused in the health-check packet to server.
    systemDns String
    Enable/disable system DNS as the probe server. Valid values: disable, enable.
    thresholdAlertJitter Double
    Alert threshold for jitter (ms, default = 0).
    thresholdAlertLatency Double
    Alert threshold for latency (ms, default = 0).
    thresholdAlertPacketloss Double
    Alert threshold for packet loss (percentage, default = 0).
    thresholdWarningJitter Double
    Warning threshold for jitter (ms, default = 0).
    thresholdWarningLatency Double
    Warning threshold for latency (ms, default = 0).
    thresholdWarningPacketloss Double
    Warning threshold for packet loss (percentage, default = 0).
    updateBgpRoute String
    Enable/disable updating the BGP route. Valid values: disable, enable.
    updateCascadeInterface String
    Enable/disable update cascade interface. Valid values: disable, enable.
    updateIfExist Boolean
    updateStaticRoute String
    Enable/disable updating the static route. Valid values: disable, enable.
    user String
    The user name to access probe server.
    vrf Double
    Virtual Routing Forwarding ID.
    wantempSystemSdwanHealthcheckId String
    an identifier for the resource with format {{name}}.
    wanprof string
    Wanprof.
    _dynamicServer string
    _Dynamic-Server.
    addrMode string
    Address mode (IPv4 or IPv6). Valid values: ipv4, ipv6.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    agentProbeTimeout number
    Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
    bandwidthWeight number
    Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
    classId string
    Traffic class ID.
    detectMode string
    The mode determining how to detect the server. Valid values: active, passive, prefer-passive.
    diffservcode string
    Differentiated services code point (DSCP) in the IP header of the probe packet.
    dnsMatchIp string
    Response IP expected from DNS server if the protocol is DNS.
    dnsRequestDomain string
    Fully qualified domain name to resolve for the DNS probe.
    dynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    embedMeasuredHealth string
    Enable/disable embedding measured health information. Valid values: disable, enable.
    failtime number
    Number of failures before server is considered lost (1 - 3600, default = 5).
    fortiguard string
    Enable/disable use of FortiGuard predefined server. Valid values: disable, enable.
    fortiguardNames string[]
    Predefined health-check target name.
    ftpFile string
    Full path and file name on the FTP server to download for FTP health-check to probe.
    ftpMode string
    FTP mode. Valid values: passive, port.
    haPriority number
    HA election priority (1 - 50).
    httpAgent string
    String in the http-agent field in the HTTP header.
    httpGet string
    URL used to communicate with the server if the protocol if the protocol is HTTP.
    httpMatch string
    Response string expected from the server if the protocol is HTTP.
    interval number
    Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
    jitterWeight number
    Coefficient of jitter in the formula of custom-profile-1.
    latencyWeight number
    Coefficient of latency in the formula of custom-profile-1.
    members string[]
    Member sequence number list.
    mosCodec string
    Codec to use for MOS calculation (default = g711). Valid values: g711, g722, g729.
    name string
    Status check or health check name.
    packetLossWeight number
    Coefficient of packet-loss in the formula of custom-profile-1.
    packetSize number
    Packet size of a twamp test session,
    passwords string[]
    Twamp controller password in authentication mode
    port number
    Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
    probeCount number
    Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
    probePackets string
    Enable/disable transmission of probe packets. Valid values: disable, enable.
    probeTimeout number
    Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
    protocol string
    Protocol used to determine if the FortiGate can communicate with the server. Valid values: ping, tcp-echo, udp-echo, http, twamp, ping6, dns, tcp-connect, ftp.
    qualityMeasuredMethod string
    Method to measure the quality of tcp-connect. Valid values: half-close, half-open.
    recoverytime number
    Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
    remoteProbeTimeout number
    Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    securityMode string
    Twamp controller security mode. Valid values: none, authentication.
    servers string[]
    IP address or FQDN name of the server.
    slaFailLogPeriod number
    Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
    slaIdRedistribute number
    Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
    slaPassLogPeriod number
    Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
    slas WantempSystemSdwanHealthcheckSla[]
    Sla. The structure of sla block is documented below.
    source string
    Source IP address used in the health-check packet to the server.
    source6 string
    Source IPv6 addressused in the health-check packet to server.
    systemDns string
    Enable/disable system DNS as the probe server. Valid values: disable, enable.
    thresholdAlertJitter number
    Alert threshold for jitter (ms, default = 0).
    thresholdAlertLatency number
    Alert threshold for latency (ms, default = 0).
    thresholdAlertPacketloss number
    Alert threshold for packet loss (percentage, default = 0).
    thresholdWarningJitter number
    Warning threshold for jitter (ms, default = 0).
    thresholdWarningLatency number
    Warning threshold for latency (ms, default = 0).
    thresholdWarningPacketloss number
    Warning threshold for packet loss (percentage, default = 0).
    updateBgpRoute string
    Enable/disable updating the BGP route. Valid values: disable, enable.
    updateCascadeInterface string
    Enable/disable update cascade interface. Valid values: disable, enable.
    updateIfExist boolean
    updateStaticRoute string
    Enable/disable updating the static route. Valid values: disable, enable.
    user string
    The user name to access probe server.
    vrf number
    Virtual Routing Forwarding ID.
    wantempSystemSdwanHealthcheckId string
    an identifier for the resource with format {{name}}.
    wanprof str
    Wanprof.
    _dynamic_server str
    _Dynamic-Server.
    addr_mode str
    Address mode (IPv4 or IPv6). Valid values: ipv4, ipv6.
    adom str
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    agent_probe_timeout float
    Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
    bandwidth_weight float
    Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
    class_id str
    Traffic class ID.
    detect_mode str
    The mode determining how to detect the server. Valid values: active, passive, prefer-passive.
    diffservcode str
    Differentiated services code point (DSCP) in the IP header of the probe packet.
    dns_match_ip str
    Response IP expected from DNS server if the protocol is DNS.
    dns_request_domain str
    Fully qualified domain name to resolve for the DNS probe.
    dynamic_sort_subtable str
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    embed_measured_health str
    Enable/disable embedding measured health information. Valid values: disable, enable.
    failtime float
    Number of failures before server is considered lost (1 - 3600, default = 5).
    fortiguard str
    Enable/disable use of FortiGuard predefined server. Valid values: disable, enable.
    fortiguard_names Sequence[str]
    Predefined health-check target name.
    ftp_file str
    Full path and file name on the FTP server to download for FTP health-check to probe.
    ftp_mode str
    FTP mode. Valid values: passive, port.
    ha_priority float
    HA election priority (1 - 50).
    http_agent str
    String in the http-agent field in the HTTP header.
    http_get str
    URL used to communicate with the server if the protocol if the protocol is HTTP.
    http_match str
    Response string expected from the server if the protocol is HTTP.
    interval float
    Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
    jitter_weight float
    Coefficient of jitter in the formula of custom-profile-1.
    latency_weight float
    Coefficient of latency in the formula of custom-profile-1.
    members Sequence[str]
    Member sequence number list.
    mos_codec str
    Codec to use for MOS calculation (default = g711). Valid values: g711, g722, g729.
    name str
    Status check or health check name.
    packet_loss_weight float
    Coefficient of packet-loss in the formula of custom-profile-1.
    packet_size float
    Packet size of a twamp test session,
    passwords Sequence[str]
    Twamp controller password in authentication mode
    port float
    Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
    probe_count float
    Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
    probe_packets str
    Enable/disable transmission of probe packets. Valid values: disable, enable.
    probe_timeout float
    Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
    protocol str
    Protocol used to determine if the FortiGate can communicate with the server. Valid values: ping, tcp-echo, udp-echo, http, twamp, ping6, dns, tcp-connect, ftp.
    quality_measured_method str
    Method to measure the quality of tcp-connect. Valid values: half-close, half-open.
    recoverytime float
    Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
    remote_probe_timeout float
    Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
    scopetype str
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    security_mode str
    Twamp controller security mode. Valid values: none, authentication.
    servers Sequence[str]
    IP address or FQDN name of the server.
    sla_fail_log_period float
    Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
    sla_id_redistribute float
    Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
    sla_pass_log_period float
    Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
    slas Sequence[WantempSystemSdwanHealthcheckSlaArgs]
    Sla. The structure of sla block is documented below.
    source str
    Source IP address used in the health-check packet to the server.
    source6 str
    Source IPv6 addressused in the health-check packet to server.
    system_dns str
    Enable/disable system DNS as the probe server. Valid values: disable, enable.
    threshold_alert_jitter float
    Alert threshold for jitter (ms, default = 0).
    threshold_alert_latency float
    Alert threshold for latency (ms, default = 0).
    threshold_alert_packetloss float
    Alert threshold for packet loss (percentage, default = 0).
    threshold_warning_jitter float
    Warning threshold for jitter (ms, default = 0).
    threshold_warning_latency float
    Warning threshold for latency (ms, default = 0).
    threshold_warning_packetloss float
    Warning threshold for packet loss (percentage, default = 0).
    update_bgp_route str
    Enable/disable updating the BGP route. Valid values: disable, enable.
    update_cascade_interface str
    Enable/disable update cascade interface. Valid values: disable, enable.
    update_if_exist bool
    update_static_route str
    Enable/disable updating the static route. Valid values: disable, enable.
    user str
    The user name to access probe server.
    vrf float
    Virtual Routing Forwarding ID.
    wantemp_system_sdwan_healthcheck_id str
    an identifier for the resource with format {{name}}.
    wanprof String
    Wanprof.
    _dynamicServer String
    _Dynamic-Server.
    addrMode String
    Address mode (IPv4 or IPv6). Valid values: ipv4, ipv6.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    agentProbeTimeout Number
    Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
    bandwidthWeight Number
    Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
    classId String
    Traffic class ID.
    detectMode String
    The mode determining how to detect the server. Valid values: active, passive, prefer-passive.
    diffservcode String
    Differentiated services code point (DSCP) in the IP header of the probe packet.
    dnsMatchIp String
    Response IP expected from DNS server if the protocol is DNS.
    dnsRequestDomain String
    Fully qualified domain name to resolve for the DNS probe.
    dynamicSortSubtable String
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    embedMeasuredHealth String
    Enable/disable embedding measured health information. Valid values: disable, enable.
    failtime Number
    Number of failures before server is considered lost (1 - 3600, default = 5).
    fortiguard String
    Enable/disable use of FortiGuard predefined server. Valid values: disable, enable.
    fortiguardNames List<String>
    Predefined health-check target name.
    ftpFile String
    Full path and file name on the FTP server to download for FTP health-check to probe.
    ftpMode String
    FTP mode. Valid values: passive, port.
    haPriority Number
    HA election priority (1 - 50).
    httpAgent String
    String in the http-agent field in the HTTP header.
    httpGet String
    URL used to communicate with the server if the protocol if the protocol is HTTP.
    httpMatch String
    Response string expected from the server if the protocol is HTTP.
    interval Number
    Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
    jitterWeight Number
    Coefficient of jitter in the formula of custom-profile-1.
    latencyWeight Number
    Coefficient of latency in the formula of custom-profile-1.
    members List<String>
    Member sequence number list.
    mosCodec String
    Codec to use for MOS calculation (default = g711). Valid values: g711, g722, g729.
    name String
    Status check or health check name.
    packetLossWeight Number
    Coefficient of packet-loss in the formula of custom-profile-1.
    packetSize Number
    Packet size of a twamp test session,
    passwords List<String>
    Twamp controller password in authentication mode
    port Number
    Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
    probeCount Number
    Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
    probePackets String
    Enable/disable transmission of probe packets. Valid values: disable, enable.
    probeTimeout Number
    Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
    protocol String
    Protocol used to determine if the FortiGate can communicate with the server. Valid values: ping, tcp-echo, udp-echo, http, twamp, ping6, dns, tcp-connect, ftp.
    qualityMeasuredMethod String
    Method to measure the quality of tcp-connect. Valid values: half-close, half-open.
    recoverytime Number
    Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
    remoteProbeTimeout Number
    Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    securityMode String
    Twamp controller security mode. Valid values: none, authentication.
    servers List<String>
    IP address or FQDN name of the server.
    slaFailLogPeriod Number
    Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
    slaIdRedistribute Number
    Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
    slaPassLogPeriod Number
    Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
    slas List<Property Map>
    Sla. The structure of sla block is documented below.
    source String
    Source IP address used in the health-check packet to the server.
    source6 String
    Source IPv6 addressused in the health-check packet to server.
    systemDns String
    Enable/disable system DNS as the probe server. Valid values: disable, enable.
    thresholdAlertJitter Number
    Alert threshold for jitter (ms, default = 0).
    thresholdAlertLatency Number
    Alert threshold for latency (ms, default = 0).
    thresholdAlertPacketloss Number
    Alert threshold for packet loss (percentage, default = 0).
    thresholdWarningJitter Number
    Warning threshold for jitter (ms, default = 0).
    thresholdWarningLatency Number
    Warning threshold for latency (ms, default = 0).
    thresholdWarningPacketloss Number
    Warning threshold for packet loss (percentage, default = 0).
    updateBgpRoute String
    Enable/disable updating the BGP route. Valid values: disable, enable.
    updateCascadeInterface String
    Enable/disable update cascade interface. Valid values: disable, enable.
    updateIfExist Boolean
    updateStaticRoute String
    Enable/disable updating the static route. Valid values: disable, enable.
    user String
    The user name to access probe server.
    vrf Number
    Virtual Routing Forwarding ID.
    wantempSystemSdwanHealthcheckId String
    an identifier for the resource with format {{name}}.

    Outputs

    All input properties are implicitly available as output properties. Additionally, the WantempSystemSdwanHealthcheck resource produces the following output properties:

    Id string
    The provider-assigned unique ID for this managed resource.
    Id string
    The provider-assigned unique ID for this managed resource.
    id string
    The provider-assigned unique ID for this managed resource.
    id String
    The provider-assigned unique ID for this managed resource.
    id string
    The provider-assigned unique ID for this managed resource.
    id str
    The provider-assigned unique ID for this managed resource.
    id String
    The provider-assigned unique ID for this managed resource.

    Look up Existing WantempSystemSdwanHealthcheck Resource

    Get an existing WantempSystemSdwanHealthcheck resource’s state with the given name, ID, and optional extra properties used to qualify the lookup.

    public static get(name: string, id: Input<ID>, state?: WantempSystemSdwanHealthcheckState, opts?: CustomResourceOptions): WantempSystemSdwanHealthcheck
    @staticmethod
    def get(resource_name: str,
            id: str,
            opts: Optional[ResourceOptions] = None,
            _dynamic_server: Optional[str] = None,
            addr_mode: Optional[str] = None,
            adom: Optional[str] = None,
            agent_probe_timeout: Optional[float] = None,
            bandwidth_weight: Optional[float] = None,
            class_id: Optional[str] = None,
            detect_mode: Optional[str] = None,
            diffservcode: Optional[str] = None,
            dns_match_ip: Optional[str] = None,
            dns_request_domain: Optional[str] = None,
            dynamic_sort_subtable: Optional[str] = None,
            embed_measured_health: Optional[str] = None,
            failtime: Optional[float] = None,
            fortiguard: Optional[str] = None,
            fortiguard_names: Optional[Sequence[str]] = None,
            ftp_file: Optional[str] = None,
            ftp_mode: Optional[str] = None,
            ha_priority: Optional[float] = None,
            http_agent: Optional[str] = None,
            http_get: Optional[str] = None,
            http_match: Optional[str] = None,
            interval: Optional[float] = None,
            jitter_weight: Optional[float] = None,
            latency_weight: Optional[float] = None,
            members: Optional[Sequence[str]] = None,
            mos_codec: Optional[str] = None,
            name: Optional[str] = None,
            packet_loss_weight: Optional[float] = None,
            packet_size: Optional[float] = None,
            passwords: Optional[Sequence[str]] = None,
            port: Optional[float] = None,
            probe_count: Optional[float] = None,
            probe_packets: Optional[str] = None,
            probe_timeout: Optional[float] = None,
            protocol: Optional[str] = None,
            quality_measured_method: Optional[str] = None,
            recoverytime: Optional[float] = None,
            remote_probe_timeout: Optional[float] = None,
            scopetype: Optional[str] = None,
            security_mode: Optional[str] = None,
            servers: Optional[Sequence[str]] = None,
            sla_fail_log_period: Optional[float] = None,
            sla_id_redistribute: Optional[float] = None,
            sla_pass_log_period: Optional[float] = None,
            slas: Optional[Sequence[WantempSystemSdwanHealthcheckSlaArgs]] = None,
            source: Optional[str] = None,
            source6: Optional[str] = None,
            system_dns: Optional[str] = None,
            threshold_alert_jitter: Optional[float] = None,
            threshold_alert_latency: Optional[float] = None,
            threshold_alert_packetloss: Optional[float] = None,
            threshold_warning_jitter: Optional[float] = None,
            threshold_warning_latency: Optional[float] = None,
            threshold_warning_packetloss: Optional[float] = None,
            update_bgp_route: Optional[str] = None,
            update_cascade_interface: Optional[str] = None,
            update_if_exist: Optional[bool] = None,
            update_static_route: Optional[str] = None,
            user: Optional[str] = None,
            vrf: Optional[float] = None,
            wanprof: Optional[str] = None,
            wantemp_system_sdwan_healthcheck_id: Optional[str] = None) -> WantempSystemSdwanHealthcheck
    func GetWantempSystemSdwanHealthcheck(ctx *Context, name string, id IDInput, state *WantempSystemSdwanHealthcheckState, opts ...ResourceOption) (*WantempSystemSdwanHealthcheck, error)
    public static WantempSystemSdwanHealthcheck Get(string name, Input<string> id, WantempSystemSdwanHealthcheckState? state, CustomResourceOptions? opts = null)
    public static WantempSystemSdwanHealthcheck get(String name, Output<String> id, WantempSystemSdwanHealthcheckState state, CustomResourceOptions options)
    resources:  _:    type: fortimanager:WantempSystemSdwanHealthcheck    get:      id: ${id}
    import {
      to = fortimanager_wantempsystemsdwanhealthcheck.example
      id = "${id}"
    }
    
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    resource_name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    The following state arguments are supported:
    AddrMode string
    Address mode (IPv4 or IPv6). Valid values: ipv4, ipv6.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    AgentProbeTimeout double
    Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
    BandwidthWeight double
    Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
    ClassId string
    Traffic class ID.
    DetectMode string
    The mode determining how to detect the server. Valid values: active, passive, prefer-passive.
    Diffservcode string
    Differentiated services code point (DSCP) in the IP header of the probe packet.
    DnsMatchIp string
    Response IP expected from DNS server if the protocol is DNS.
    DnsRequestDomain string
    Fully qualified domain name to resolve for the DNS probe.
    DynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    EmbedMeasuredHealth string
    Enable/disable embedding measured health information. Valid values: disable, enable.
    Failtime double
    Number of failures before server is considered lost (1 - 3600, default = 5).
    Fortiguard string
    Enable/disable use of FortiGuard predefined server. Valid values: disable, enable.
    FortiguardNames List<string>
    Predefined health-check target name.
    FtpFile string
    Full path and file name on the FTP server to download for FTP health-check to probe.
    FtpMode string
    FTP mode. Valid values: passive, port.
    HaPriority double
    HA election priority (1 - 50).
    HttpAgent string
    String in the http-agent field in the HTTP header.
    HttpGet string
    URL used to communicate with the server if the protocol if the protocol is HTTP.
    HttpMatch string
    Response string expected from the server if the protocol is HTTP.
    Interval double
    Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
    JitterWeight double
    Coefficient of jitter in the formula of custom-profile-1.
    LatencyWeight double
    Coefficient of latency in the formula of custom-profile-1.
    Members List<string>
    Member sequence number list.
    MosCodec string
    Codec to use for MOS calculation (default = g711). Valid values: g711, g722, g729.
    Name string
    Status check or health check name.
    PacketLossWeight double
    Coefficient of packet-loss in the formula of custom-profile-1.
    PacketSize double
    Packet size of a twamp test session,
    Passwords List<string>
    Twamp controller password in authentication mode
    Port double
    Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
    ProbeCount double
    Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
    ProbePackets string
    Enable/disable transmission of probe packets. Valid values: disable, enable.
    ProbeTimeout double
    Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
    Protocol string
    Protocol used to determine if the FortiGate can communicate with the server. Valid values: ping, tcp-echo, udp-echo, http, twamp, ping6, dns, tcp-connect, ftp.
    QualityMeasuredMethod string
    Method to measure the quality of tcp-connect. Valid values: half-close, half-open.
    Recoverytime double
    Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
    RemoteProbeTimeout double
    Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    SecurityMode string
    Twamp controller security mode. Valid values: none, authentication.
    Servers List<string>
    IP address or FQDN name of the server.
    SlaFailLogPeriod double
    Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
    SlaIdRedistribute double
    Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
    SlaPassLogPeriod double
    Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
    Slas List<WantempSystemSdwanHealthcheckSla>
    Sla. The structure of sla block is documented below.
    Source string
    Source IP address used in the health-check packet to the server.
    Source6 string
    Source IPv6 addressused in the health-check packet to server.
    SystemDns string
    Enable/disable system DNS as the probe server. Valid values: disable, enable.
    ThresholdAlertJitter double
    Alert threshold for jitter (ms, default = 0).
    ThresholdAlertLatency double
    Alert threshold for latency (ms, default = 0).
    ThresholdAlertPacketloss double
    Alert threshold for packet loss (percentage, default = 0).
    ThresholdWarningJitter double
    Warning threshold for jitter (ms, default = 0).
    ThresholdWarningLatency double
    Warning threshold for latency (ms, default = 0).
    ThresholdWarningPacketloss double
    Warning threshold for packet loss (percentage, default = 0).
    UpdateBgpRoute string
    Enable/disable updating the BGP route. Valid values: disable, enable.
    UpdateCascadeInterface string
    Enable/disable update cascade interface. Valid values: disable, enable.
    UpdateIfExist bool
    UpdateStaticRoute string
    Enable/disable updating the static route. Valid values: disable, enable.
    User string
    The user name to access probe server.
    Vrf double
    Virtual Routing Forwarding ID.
    Wanprof string
    Wanprof.
    WantempSystemSdwanHealthcheckId string
    an identifier for the resource with format {{name}}.
    _dynamicServer string
    _Dynamic-Server.
    AddrMode string
    Address mode (IPv4 or IPv6). Valid values: ipv4, ipv6.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    AgentProbeTimeout float64
    Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
    BandwidthWeight float64
    Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
    ClassId string
    Traffic class ID.
    DetectMode string
    The mode determining how to detect the server. Valid values: active, passive, prefer-passive.
    Diffservcode string
    Differentiated services code point (DSCP) in the IP header of the probe packet.
    DnsMatchIp string
    Response IP expected from DNS server if the protocol is DNS.
    DnsRequestDomain string
    Fully qualified domain name to resolve for the DNS probe.
    DynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    EmbedMeasuredHealth string
    Enable/disable embedding measured health information. Valid values: disable, enable.
    Failtime float64
    Number of failures before server is considered lost (1 - 3600, default = 5).
    Fortiguard string
    Enable/disable use of FortiGuard predefined server. Valid values: disable, enable.
    FortiguardNames []string
    Predefined health-check target name.
    FtpFile string
    Full path and file name on the FTP server to download for FTP health-check to probe.
    FtpMode string
    FTP mode. Valid values: passive, port.
    HaPriority float64
    HA election priority (1 - 50).
    HttpAgent string
    String in the http-agent field in the HTTP header.
    HttpGet string
    URL used to communicate with the server if the protocol if the protocol is HTTP.
    HttpMatch string
    Response string expected from the server if the protocol is HTTP.
    Interval float64
    Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
    JitterWeight float64
    Coefficient of jitter in the formula of custom-profile-1.
    LatencyWeight float64
    Coefficient of latency in the formula of custom-profile-1.
    Members []string
    Member sequence number list.
    MosCodec string
    Codec to use for MOS calculation (default = g711). Valid values: g711, g722, g729.
    Name string
    Status check or health check name.
    PacketLossWeight float64
    Coefficient of packet-loss in the formula of custom-profile-1.
    PacketSize float64
    Packet size of a twamp test session,
    Passwords []string
    Twamp controller password in authentication mode
    Port float64
    Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
    ProbeCount float64
    Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
    ProbePackets string
    Enable/disable transmission of probe packets. Valid values: disable, enable.
    ProbeTimeout float64
    Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
    Protocol string
    Protocol used to determine if the FortiGate can communicate with the server. Valid values: ping, tcp-echo, udp-echo, http, twamp, ping6, dns, tcp-connect, ftp.
    QualityMeasuredMethod string
    Method to measure the quality of tcp-connect. Valid values: half-close, half-open.
    Recoverytime float64
    Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
    RemoteProbeTimeout float64
    Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    SecurityMode string
    Twamp controller security mode. Valid values: none, authentication.
    Servers []string
    IP address or FQDN name of the server.
    SlaFailLogPeriod float64
    Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
    SlaIdRedistribute float64
    Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
    SlaPassLogPeriod float64
    Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
    Slas []WantempSystemSdwanHealthcheckSlaTypeArgs
    Sla. The structure of sla block is documented below.
    Source string
    Source IP address used in the health-check packet to the server.
    Source6 string
    Source IPv6 addressused in the health-check packet to server.
    SystemDns string
    Enable/disable system DNS as the probe server. Valid values: disable, enable.
    ThresholdAlertJitter float64
    Alert threshold for jitter (ms, default = 0).
    ThresholdAlertLatency float64
    Alert threshold for latency (ms, default = 0).
    ThresholdAlertPacketloss float64
    Alert threshold for packet loss (percentage, default = 0).
    ThresholdWarningJitter float64
    Warning threshold for jitter (ms, default = 0).
    ThresholdWarningLatency float64
    Warning threshold for latency (ms, default = 0).
    ThresholdWarningPacketloss float64
    Warning threshold for packet loss (percentage, default = 0).
    UpdateBgpRoute string
    Enable/disable updating the BGP route. Valid values: disable, enable.
    UpdateCascadeInterface string
    Enable/disable update cascade interface. Valid values: disable, enable.
    UpdateIfExist bool
    UpdateStaticRoute string
    Enable/disable updating the static route. Valid values: disable, enable.
    User string
    The user name to access probe server.
    Vrf float64
    Virtual Routing Forwarding ID.
    Wanprof string
    Wanprof.
    WantempSystemSdwanHealthcheckId string
    an identifier for the resource with format {{name}}.
    _dynamicServer string
    _Dynamic-Server.
    _dynamic_server string
    _Dynamic-Server.
    addr_mode string
    Address mode (IPv4 or IPv6). Valid values: ipv4, ipv6.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    agent_probe_timeout number
    Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
    bandwidth_weight number
    Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
    class_id string
    Traffic class ID.
    detect_mode string
    The mode determining how to detect the server. Valid values: active, passive, prefer-passive.
    diffservcode string
    Differentiated services code point (DSCP) in the IP header of the probe packet.
    dns_match_ip string
    Response IP expected from DNS server if the protocol is DNS.
    dns_request_domain string
    Fully qualified domain name to resolve for the DNS probe.
    dynamic_sort_subtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    embed_measured_health string
    Enable/disable embedding measured health information. Valid values: disable, enable.
    failtime number
    Number of failures before server is considered lost (1 - 3600, default = 5).
    fortiguard string
    Enable/disable use of FortiGuard predefined server. Valid values: disable, enable.
    fortiguard_names list(string)
    Predefined health-check target name.
    ftp_file string
    Full path and file name on the FTP server to download for FTP health-check to probe.
    ftp_mode string
    FTP mode. Valid values: passive, port.
    ha_priority number
    HA election priority (1 - 50).
    http_agent string
    String in the http-agent field in the HTTP header.
    http_get string
    URL used to communicate with the server if the protocol if the protocol is HTTP.
    http_match string
    Response string expected from the server if the protocol is HTTP.
    interval number
    Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
    jitter_weight number
    Coefficient of jitter in the formula of custom-profile-1.
    latency_weight number
    Coefficient of latency in the formula of custom-profile-1.
    members list(string)
    Member sequence number list.
    mos_codec string
    Codec to use for MOS calculation (default = g711). Valid values: g711, g722, g729.
    name string
    Status check or health check name.
    packet_loss_weight number
    Coefficient of packet-loss in the formula of custom-profile-1.
    packet_size number
    Packet size of a twamp test session,
    passwords list(string)
    Twamp controller password in authentication mode
    port number
    Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
    probe_count number
    Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
    probe_packets string
    Enable/disable transmission of probe packets. Valid values: disable, enable.
    probe_timeout number
    Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
    protocol string
    Protocol used to determine if the FortiGate can communicate with the server. Valid values: ping, tcp-echo, udp-echo, http, twamp, ping6, dns, tcp-connect, ftp.
    quality_measured_method string
    Method to measure the quality of tcp-connect. Valid values: half-close, half-open.
    recoverytime number
    Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
    remote_probe_timeout number
    Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    security_mode string
    Twamp controller security mode. Valid values: none, authentication.
    servers list(string)
    IP address or FQDN name of the server.
    sla_fail_log_period number
    Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
    sla_id_redistribute number
    Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
    sla_pass_log_period number
    Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
    slas list(object)
    Sla. The structure of sla block is documented below.
    source string
    Source IP address used in the health-check packet to the server.
    source6 string
    Source IPv6 addressused in the health-check packet to server.
    system_dns string
    Enable/disable system DNS as the probe server. Valid values: disable, enable.
    threshold_alert_jitter number
    Alert threshold for jitter (ms, default = 0).
    threshold_alert_latency number
    Alert threshold for latency (ms, default = 0).
    threshold_alert_packetloss number
    Alert threshold for packet loss (percentage, default = 0).
    threshold_warning_jitter number
    Warning threshold for jitter (ms, default = 0).
    threshold_warning_latency number
    Warning threshold for latency (ms, default = 0).
    threshold_warning_packetloss number
    Warning threshold for packet loss (percentage, default = 0).
    update_bgp_route string
    Enable/disable updating the BGP route. Valid values: disable, enable.
    update_cascade_interface string
    Enable/disable update cascade interface. Valid values: disable, enable.
    update_if_exist bool
    update_static_route string
    Enable/disable updating the static route. Valid values: disable, enable.
    user string
    The user name to access probe server.
    vrf number
    Virtual Routing Forwarding ID.
    wanprof string
    Wanprof.
    wantemp_system_sdwan_healthcheck_id string
    an identifier for the resource with format {{name}}.
    _dynamicServer String
    _Dynamic-Server.
    addrMode String
    Address mode (IPv4 or IPv6). Valid values: ipv4, ipv6.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    agentProbeTimeout Double
    Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
    bandwidthWeight Double
    Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
    classId String
    Traffic class ID.
    detectMode String
    The mode determining how to detect the server. Valid values: active, passive, prefer-passive.
    diffservcode String
    Differentiated services code point (DSCP) in the IP header of the probe packet.
    dnsMatchIp String
    Response IP expected from DNS server if the protocol is DNS.
    dnsRequestDomain String
    Fully qualified domain name to resolve for the DNS probe.
    dynamicSortSubtable String
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    embedMeasuredHealth String
    Enable/disable embedding measured health information. Valid values: disable, enable.
    failtime Double
    Number of failures before server is considered lost (1 - 3600, default = 5).
    fortiguard String
    Enable/disable use of FortiGuard predefined server. Valid values: disable, enable.
    fortiguardNames List<String>
    Predefined health-check target name.
    ftpFile String
    Full path and file name on the FTP server to download for FTP health-check to probe.
    ftpMode String
    FTP mode. Valid values: passive, port.
    haPriority Double
    HA election priority (1 - 50).
    httpAgent String
    String in the http-agent field in the HTTP header.
    httpGet String
    URL used to communicate with the server if the protocol if the protocol is HTTP.
    httpMatch String
    Response string expected from the server if the protocol is HTTP.
    interval Double
    Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
    jitterWeight Double
    Coefficient of jitter in the formula of custom-profile-1.
    latencyWeight Double
    Coefficient of latency in the formula of custom-profile-1.
    members List<String>
    Member sequence number list.
    mosCodec String
    Codec to use for MOS calculation (default = g711). Valid values: g711, g722, g729.
    name String
    Status check or health check name.
    packetLossWeight Double
    Coefficient of packet-loss in the formula of custom-profile-1.
    packetSize Double
    Packet size of a twamp test session,
    passwords List<String>
    Twamp controller password in authentication mode
    port Double
    Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
    probeCount Double
    Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
    probePackets String
    Enable/disable transmission of probe packets. Valid values: disable, enable.
    probeTimeout Double
    Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
    protocol String
    Protocol used to determine if the FortiGate can communicate with the server. Valid values: ping, tcp-echo, udp-echo, http, twamp, ping6, dns, tcp-connect, ftp.
    qualityMeasuredMethod String
    Method to measure the quality of tcp-connect. Valid values: half-close, half-open.
    recoverytime Double
    Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
    remoteProbeTimeout Double
    Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    securityMode String
    Twamp controller security mode. Valid values: none, authentication.
    servers List<String>
    IP address or FQDN name of the server.
    slaFailLogPeriod Double
    Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
    slaIdRedistribute Double
    Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
    slaPassLogPeriod Double
    Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
    slas List<WantempSystemSdwanHealthcheckSla>
    Sla. The structure of sla block is documented below.
    source String
    Source IP address used in the health-check packet to the server.
    source6 String
    Source IPv6 addressused in the health-check packet to server.
    systemDns String
    Enable/disable system DNS as the probe server. Valid values: disable, enable.
    thresholdAlertJitter Double
    Alert threshold for jitter (ms, default = 0).
    thresholdAlertLatency Double
    Alert threshold for latency (ms, default = 0).
    thresholdAlertPacketloss Double
    Alert threshold for packet loss (percentage, default = 0).
    thresholdWarningJitter Double
    Warning threshold for jitter (ms, default = 0).
    thresholdWarningLatency Double
    Warning threshold for latency (ms, default = 0).
    thresholdWarningPacketloss Double
    Warning threshold for packet loss (percentage, default = 0).
    updateBgpRoute String
    Enable/disable updating the BGP route. Valid values: disable, enable.
    updateCascadeInterface String
    Enable/disable update cascade interface. Valid values: disable, enable.
    updateIfExist Boolean
    updateStaticRoute String
    Enable/disable updating the static route. Valid values: disable, enable.
    user String
    The user name to access probe server.
    vrf Double
    Virtual Routing Forwarding ID.
    wanprof String
    Wanprof.
    wantempSystemSdwanHealthcheckId String
    an identifier for the resource with format {{name}}.
    _dynamicServer string
    _Dynamic-Server.
    addrMode string
    Address mode (IPv4 or IPv6). Valid values: ipv4, ipv6.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    agentProbeTimeout number
    Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
    bandwidthWeight number
    Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
    classId string
    Traffic class ID.
    detectMode string
    The mode determining how to detect the server. Valid values: active, passive, prefer-passive.
    diffservcode string
    Differentiated services code point (DSCP) in the IP header of the probe packet.
    dnsMatchIp string
    Response IP expected from DNS server if the protocol is DNS.
    dnsRequestDomain string
    Fully qualified domain name to resolve for the DNS probe.
    dynamicSortSubtable string
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    embedMeasuredHealth string
    Enable/disable embedding measured health information. Valid values: disable, enable.
    failtime number
    Number of failures before server is considered lost (1 - 3600, default = 5).
    fortiguard string
    Enable/disable use of FortiGuard predefined server. Valid values: disable, enable.
    fortiguardNames string[]
    Predefined health-check target name.
    ftpFile string
    Full path and file name on the FTP server to download for FTP health-check to probe.
    ftpMode string
    FTP mode. Valid values: passive, port.
    haPriority number
    HA election priority (1 - 50).
    httpAgent string
    String in the http-agent field in the HTTP header.
    httpGet string
    URL used to communicate with the server if the protocol if the protocol is HTTP.
    httpMatch string
    Response string expected from the server if the protocol is HTTP.
    interval number
    Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
    jitterWeight number
    Coefficient of jitter in the formula of custom-profile-1.
    latencyWeight number
    Coefficient of latency in the formula of custom-profile-1.
    members string[]
    Member sequence number list.
    mosCodec string
    Codec to use for MOS calculation (default = g711). Valid values: g711, g722, g729.
    name string
    Status check or health check name.
    packetLossWeight number
    Coefficient of packet-loss in the formula of custom-profile-1.
    packetSize number
    Packet size of a twamp test session,
    passwords string[]
    Twamp controller password in authentication mode
    port number
    Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
    probeCount number
    Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
    probePackets string
    Enable/disable transmission of probe packets. Valid values: disable, enable.
    probeTimeout number
    Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
    protocol string
    Protocol used to determine if the FortiGate can communicate with the server. Valid values: ping, tcp-echo, udp-echo, http, twamp, ping6, dns, tcp-connect, ftp.
    qualityMeasuredMethod string
    Method to measure the quality of tcp-connect. Valid values: half-close, half-open.
    recoverytime number
    Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
    remoteProbeTimeout number
    Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    securityMode string
    Twamp controller security mode. Valid values: none, authentication.
    servers string[]
    IP address or FQDN name of the server.
    slaFailLogPeriod number
    Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
    slaIdRedistribute number
    Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
    slaPassLogPeriod number
    Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
    slas WantempSystemSdwanHealthcheckSla[]
    Sla. The structure of sla block is documented below.
    source string
    Source IP address used in the health-check packet to the server.
    source6 string
    Source IPv6 addressused in the health-check packet to server.
    systemDns string
    Enable/disable system DNS as the probe server. Valid values: disable, enable.
    thresholdAlertJitter number
    Alert threshold for jitter (ms, default = 0).
    thresholdAlertLatency number
    Alert threshold for latency (ms, default = 0).
    thresholdAlertPacketloss number
    Alert threshold for packet loss (percentage, default = 0).
    thresholdWarningJitter number
    Warning threshold for jitter (ms, default = 0).
    thresholdWarningLatency number
    Warning threshold for latency (ms, default = 0).
    thresholdWarningPacketloss number
    Warning threshold for packet loss (percentage, default = 0).
    updateBgpRoute string
    Enable/disable updating the BGP route. Valid values: disable, enable.
    updateCascadeInterface string
    Enable/disable update cascade interface. Valid values: disable, enable.
    updateIfExist boolean
    updateStaticRoute string
    Enable/disable updating the static route. Valid values: disable, enable.
    user string
    The user name to access probe server.
    vrf number
    Virtual Routing Forwarding ID.
    wanprof string
    Wanprof.
    wantempSystemSdwanHealthcheckId string
    an identifier for the resource with format {{name}}.
    _dynamic_server str
    _Dynamic-Server.
    addr_mode str
    Address mode (IPv4 or IPv6). Valid values: ipv4, ipv6.
    adom str
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    agent_probe_timeout float
    Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
    bandwidth_weight float
    Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
    class_id str
    Traffic class ID.
    detect_mode str
    The mode determining how to detect the server. Valid values: active, passive, prefer-passive.
    diffservcode str
    Differentiated services code point (DSCP) in the IP header of the probe packet.
    dns_match_ip str
    Response IP expected from DNS server if the protocol is DNS.
    dns_request_domain str
    Fully qualified domain name to resolve for the DNS probe.
    dynamic_sort_subtable str
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    embed_measured_health str
    Enable/disable embedding measured health information. Valid values: disable, enable.
    failtime float
    Number of failures before server is considered lost (1 - 3600, default = 5).
    fortiguard str
    Enable/disable use of FortiGuard predefined server. Valid values: disable, enable.
    fortiguard_names Sequence[str]
    Predefined health-check target name.
    ftp_file str
    Full path and file name on the FTP server to download for FTP health-check to probe.
    ftp_mode str
    FTP mode. Valid values: passive, port.
    ha_priority float
    HA election priority (1 - 50).
    http_agent str
    String in the http-agent field in the HTTP header.
    http_get str
    URL used to communicate with the server if the protocol if the protocol is HTTP.
    http_match str
    Response string expected from the server if the protocol is HTTP.
    interval float
    Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
    jitter_weight float
    Coefficient of jitter in the formula of custom-profile-1.
    latency_weight float
    Coefficient of latency in the formula of custom-profile-1.
    members Sequence[str]
    Member sequence number list.
    mos_codec str
    Codec to use for MOS calculation (default = g711). Valid values: g711, g722, g729.
    name str
    Status check or health check name.
    packet_loss_weight float
    Coefficient of packet-loss in the formula of custom-profile-1.
    packet_size float
    Packet size of a twamp test session,
    passwords Sequence[str]
    Twamp controller password in authentication mode
    port float
    Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
    probe_count float
    Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
    probe_packets str
    Enable/disable transmission of probe packets. Valid values: disable, enable.
    probe_timeout float
    Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
    protocol str
    Protocol used to determine if the FortiGate can communicate with the server. Valid values: ping, tcp-echo, udp-echo, http, twamp, ping6, dns, tcp-connect, ftp.
    quality_measured_method str
    Method to measure the quality of tcp-connect. Valid values: half-close, half-open.
    recoverytime float
    Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
    remote_probe_timeout float
    Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
    scopetype str
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    security_mode str
    Twamp controller security mode. Valid values: none, authentication.
    servers Sequence[str]
    IP address or FQDN name of the server.
    sla_fail_log_period float
    Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
    sla_id_redistribute float
    Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
    sla_pass_log_period float
    Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
    slas Sequence[WantempSystemSdwanHealthcheckSlaArgs]
    Sla. The structure of sla block is documented below.
    source str
    Source IP address used in the health-check packet to the server.
    source6 str
    Source IPv6 addressused in the health-check packet to server.
    system_dns str
    Enable/disable system DNS as the probe server. Valid values: disable, enable.
    threshold_alert_jitter float
    Alert threshold for jitter (ms, default = 0).
    threshold_alert_latency float
    Alert threshold for latency (ms, default = 0).
    threshold_alert_packetloss float
    Alert threshold for packet loss (percentage, default = 0).
    threshold_warning_jitter float
    Warning threshold for jitter (ms, default = 0).
    threshold_warning_latency float
    Warning threshold for latency (ms, default = 0).
    threshold_warning_packetloss float
    Warning threshold for packet loss (percentage, default = 0).
    update_bgp_route str
    Enable/disable updating the BGP route. Valid values: disable, enable.
    update_cascade_interface str
    Enable/disable update cascade interface. Valid values: disable, enable.
    update_if_exist bool
    update_static_route str
    Enable/disable updating the static route. Valid values: disable, enable.
    user str
    The user name to access probe server.
    vrf float
    Virtual Routing Forwarding ID.
    wanprof str
    Wanprof.
    wantemp_system_sdwan_healthcheck_id str
    an identifier for the resource with format {{name}}.
    _dynamicServer String
    _Dynamic-Server.
    addrMode String
    Address mode (IPv4 or IPv6). Valid values: ipv4, ipv6.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    agentProbeTimeout Number
    Time to wait before a probe packet is considered lost when detect-mode is agent (5000 - 3600*1000 msec, default = 60000).
    bandwidthWeight Number
    Coefficient of reciprocal of available bidirectional bandwidth in the formula of custom-profile-1.
    classId String
    Traffic class ID.
    detectMode String
    The mode determining how to detect the server. Valid values: active, passive, prefer-passive.
    diffservcode String
    Differentiated services code point (DSCP) in the IP header of the probe packet.
    dnsMatchIp String
    Response IP expected from DNS server if the protocol is DNS.
    dnsRequestDomain String
    Fully qualified domain name to resolve for the DNS probe.
    dynamicSortSubtable String
    true or false, set this parameter to true when using dynamic for_each + toset to configure and sort sub-tables, please do not set this parameter when configuring static sub-tables.
    embedMeasuredHealth String
    Enable/disable embedding measured health information. Valid values: disable, enable.
    failtime Number
    Number of failures before server is considered lost (1 - 3600, default = 5).
    fortiguard String
    Enable/disable use of FortiGuard predefined server. Valid values: disable, enable.
    fortiguardNames List<String>
    Predefined health-check target name.
    ftpFile String
    Full path and file name on the FTP server to download for FTP health-check to probe.
    ftpMode String
    FTP mode. Valid values: passive, port.
    haPriority Number
    HA election priority (1 - 50).
    httpAgent String
    String in the http-agent field in the HTTP header.
    httpGet String
    URL used to communicate with the server if the protocol if the protocol is HTTP.
    httpMatch String
    Response string expected from the server if the protocol is HTTP.
    interval Number
    Status check interval in milliseconds, or the time between attempting to connect to the server (500 - 3600*1000 msec, default = 500).
    jitterWeight Number
    Coefficient of jitter in the formula of custom-profile-1.
    latencyWeight Number
    Coefficient of latency in the formula of custom-profile-1.
    members List<String>
    Member sequence number list.
    mosCodec String
    Codec to use for MOS calculation (default = g711). Valid values: g711, g722, g729.
    name String
    Status check or health check name.
    packetLossWeight Number
    Coefficient of packet-loss in the formula of custom-profile-1.
    packetSize Number
    Packet size of a twamp test session,
    passwords List<String>
    Twamp controller password in authentication mode
    port Number
    Port number used to communicate with the server over the selected protocol (0-65535, default = 0, auto select. http, twamp: 80, udp-echo, tcp-echo: 7, dns: 53, ftp: 21).
    probeCount Number
    Number of most recent probes that should be used to calculate latency and jitter (5 - 30, default = 30).
    probePackets String
    Enable/disable transmission of probe packets. Valid values: disable, enable.
    probeTimeout Number
    Time to wait before a probe packet is considered lost (500 - 3600*1000 msec, default = 500).
    protocol String
    Protocol used to determine if the FortiGate can communicate with the server. Valid values: ping, tcp-echo, udp-echo, http, twamp, ping6, dns, tcp-connect, ftp.
    qualityMeasuredMethod String
    Method to measure the quality of tcp-connect. Valid values: half-close, half-open.
    recoverytime Number
    Number of successful responses received before server is considered recovered (1 - 3600, default = 5).
    remoteProbeTimeout Number
    Time to wait before a probe packet is considered lost when detect-mode is remote (20 - 3600*1000 msec, default = 5000).
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    securityMode String
    Twamp controller security mode. Valid values: none, authentication.
    servers List<String>
    IP address or FQDN name of the server.
    slaFailLogPeriod Number
    Time interval in seconds that SLA fail log messages will be generated (0 - 3600, default = 0).
    slaIdRedistribute Number
    Select the ID from the SLA sub-table. The selected SLA's priority value will be distributed into the routing table (0 - 32, default = 0).
    slaPassLogPeriod Number
    Time interval in seconds that SLA pass log messages will be generated (0 - 3600, default = 0).
    slas List<Property Map>
    Sla. The structure of sla block is documented below.
    source String
    Source IP address used in the health-check packet to the server.
    source6 String
    Source IPv6 addressused in the health-check packet to server.
    systemDns String
    Enable/disable system DNS as the probe server. Valid values: disable, enable.
    thresholdAlertJitter Number
    Alert threshold for jitter (ms, default = 0).
    thresholdAlertLatency Number
    Alert threshold for latency (ms, default = 0).
    thresholdAlertPacketloss Number
    Alert threshold for packet loss (percentage, default = 0).
    thresholdWarningJitter Number
    Warning threshold for jitter (ms, default = 0).
    thresholdWarningLatency Number
    Warning threshold for latency (ms, default = 0).
    thresholdWarningPacketloss Number
    Warning threshold for packet loss (percentage, default = 0).
    updateBgpRoute String
    Enable/disable updating the BGP route. Valid values: disable, enable.
    updateCascadeInterface String
    Enable/disable update cascade interface. Valid values: disable, enable.
    updateIfExist Boolean
    updateStaticRoute String
    Enable/disable updating the static route. Valid values: disable, enable.
    user String
    The user name to access probe server.
    vrf Number
    Virtual Routing Forwarding ID.
    wanprof String
    Wanprof.
    wantempSystemSdwanHealthcheckId String
    an identifier for the resource with format {{name}}.

    Supporting Types

    WantempSystemSdwanHealthcheckSla, WantempSystemSdwanHealthcheckSlaArgs

    CustomProfileThreshold double
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    Id double
    SLA ID.
    JitterThreshold double
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    LatencyThreshold double
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    LinkCostFactors List<string>
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    MosThreshold string
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    PacketlossThreshold double
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    PriorityInSla double
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    PriorityOutSla double
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    CustomProfileThreshold float64
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    Id float64
    SLA ID.
    JitterThreshold float64
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    LatencyThreshold float64
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    LinkCostFactors []string
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    MosThreshold string
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    PacketlossThreshold float64
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    PriorityInSla float64
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    PriorityOutSla float64
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    custom_profile_threshold number
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    id number
    SLA ID.
    jitter_threshold number
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    latency_threshold number
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    link_cost_factors list(string)
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    mos_threshold string
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    packetloss_threshold number
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    priority_in_sla number
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    priority_out_sla number
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    customProfileThreshold Double
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    id Double
    SLA ID.
    jitterThreshold Double
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    latencyThreshold Double
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    linkCostFactors List<String>
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    mosThreshold String
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    packetlossThreshold Double
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    priorityInSla Double
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    priorityOutSla Double
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    customProfileThreshold number
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    id number
    SLA ID.
    jitterThreshold number
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    latencyThreshold number
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    linkCostFactors string[]
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    mosThreshold string
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    packetlossThreshold number
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    priorityInSla number
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    priorityOutSla number
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    custom_profile_threshold float
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    id float
    SLA ID.
    jitter_threshold float
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    latency_threshold float
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    link_cost_factors Sequence[str]
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    mos_threshold str
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    packetloss_threshold float
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    priority_in_sla float
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    priority_out_sla float
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).
    customProfileThreshold Number
    Custom profile threshold for SLA to be marked as pass(0 - 10000000, default = 0).
    id Number
    SLA ID.
    jitterThreshold Number
    Jitter for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    latencyThreshold Number
    Latency for SLA to make decision in milliseconds. (0 - 10000000, default = 5).
    linkCostFactors List<String>
    Criteria on which to base link selection. Valid values: latency, jitter, packet-loss.
    mosThreshold String
    Minimum Mean Opinion Score for SLA to be marked as pass. (1.0 - 5.0, default = 3.6).
    packetlossThreshold Number
    Packet loss for SLA to make decision in percentage. (0 - 100, default = 0).
    priorityInSla Number
    Value to be distributed into routing table when in-sla (0 - 65535, default = 0).
    priorityOutSla Number
    Value to be distributed into routing table when out-sla (0 - 65535, default = 0).

    Import

    Wantemp SystemSdwanHealthCheck can be imported using any of these accepted formats:

    Set import_options = [“wanprof=YOUR_VALUE”] in the provider section.

    $ export “FORTIMANAGER_IMPORT_TABLE”=“true”

    $ pulumi import fortimanager:index/wantempSystemSdwanHealthcheck:WantempSystemSdwanHealthcheck labelname {{name}}
    

    $ unset “FORTIMANAGER_IMPORT_TABLE”

    -> Hint: The scopetype and adom for import will directly inherit the scopetype and adom configuration of the provider.

    To learn more about importing existing cloud resources, see Importing resources.

    Package Details

    Repository
    fortimanager fortinetdev/terraform-provider-fortimanager
    License
    Notes
    This Pulumi package is based on the fortimanager Terraform Provider.
    Viewing docs for fortimanager 1.17.0
    published on Monday, May 4, 2026 by fortinetdev

      Try Pulumi Cloud free.
      Your team will thank you.

      Start free trial